ELISA Recombinant Rat Oxidized low-density lipoprotein receptor 1(Olr1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O70156 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ Protein Names:Recommended name: Oxidized low-density lipoprotein receptor 1 Short name= Ox-LDL receptor 1 Alternative name(s): Lectin-like oxidized LDL receptor 1 Short name= LOX-1 Short name= Lectin-like oxLDL receptor 1 Lectin-type oxidized LDL receptor 1 Cleaved into the following chain: 1. Oxidized low-density lipoprotein receptor 1, soluble form Gene Names:Name:Olr1 Synonyms:Lox1, Oldlr1 Expression Region:1-364 Sequence Info:fµLl length protein