Skip to Content

ELISA Recombinant Saimiri boliviensis boliviensis Short-wave-sensitive opsin 1(OPN1SW)

https://www.anagnostics.com/web/image/product.template/155154/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saimiri boliviensis boliviensis (Bolivian squirrel monkey) Uniprot NO.:O13092 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKMPEEEEFYLFKNISSVGPWDGPQYHIAPVWAFQLQAAFMGIVFLAGLPLNSMVLVAT VRYKKLRHPLNYVLVNVSVGGFLLCIFSVLPVFVNSCNGYFVFGRHVCALEGFLGTVAGL VTGWSLAFLAFERYIVICKPFGNFRFSSKHALMVVLTTWTIGIGVSIPPFFGWSRYIAEG LQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIVPLSLICFSYAQLLRALKAVAAQQQESAT TQKAEREVSRMVVVMVGSFCVCYVPYAALAMYMVNNRNHGLDLRLVSIPAFFSKSSCIYN PIIYCFMNKQFRACIMEMVCGKAMTDESDISSSQKTEVSTVSSSQVGPN Protein Names:Recommended name: Short-wave-sensitive opsin 1 Alternative name(s): Blue cone photoreceptor pigment Blue-sensitive opsin Short name= BOP Gene Names:Name:OPN1SW Synonyms:BCP Expression Region:1-349 Sequence Info:fµLl length protein

1,703.00 € 1703.0 EUR 1,703.00 €

1,703.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.