ELISA Recombinant Rat Olfactory receptor 51E2(Or51e2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O88628 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSCNFTHATFmLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL FLCmLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRAVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDIEAGGNT Protein Names:Recommended name: Olfactory receptor 51E2 Alternative name(s): G-protein coupled receptor RA1c Olfactory receptor 59 Gene Names:Name:Or51e2 Synonyms:Olr59 Expression Region:1-320 Sequence Info:FµLl length protein