ELISA Recombinant Rat P2Y purinoceptor 2(P2ry2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P41232 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAGLDSWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYAQGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLHSLSWGHARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR ITCHDTSARELFSHFVAYSSVmLGLLFAVPFSIILVCYVLMARRLLKPAYGTTGLPRAKR KSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSCL DPVLYFLAGQRLVRFARDAKPATEPTPSPQARRKLGLHRPNRTDTVRKDLSISSDDSRRT ESTPAGSETKDIRL Protein Names:Recommended name: P2Y purinoceptor 2 Short name= P2Y2 Alternative name(s): ATP receptor P2U purinoceptor 1 Short name= P2U1 Purinergic receptor Gene Names:Name:P2ry2 Synonyms:P2ru1 Expression Region:1-374 Sequence Info:FµLl length protein