ELISA Recombinant Rat Phosphatidylethanolamine N-methyltransferase(Pemt)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q08388 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SWLLGYVDPTEPSFVAAVLTIVFNPLFWNVVARWEQRTRKLSRAFGSPYLACYSLGSIIL LLNILRSHCFTQAMMSQPKMEGLDSHTIYFLGLALLGWGLVFVLSSFYALGFTGTFLGDY FGILKESRVTTFPFSVLDNPMYWGSTANYLGWALMHASPTGLLLTVLVALVYVVALLFEE PFTAEIYRRKATRLHKRS Protein Names:Recommended name: Phosphatidylethanolamine N-methyltransferase Short name= PEAMT Short name= PEMT EC= 2.1.1.17 Gene Names:Name:Pemt Synonyms:Pempt Expression Region:2-199 Sequence Info:fµLl length protein