ELISA Recombinant Schizosaccharomyces pombe Peroxisomal membrane protein pex13(pex13)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O14136 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METNQNEKGPSLPSYPAGGIMSVSNSNADTNQGVTQHPLANRIVNPNYYNMGFNPYSGFN SFIPSFNPFVPLETNLPGNGPISSLQVIESIVGAVGSIAQVLESTLMAAHMSYNTFVSVS ENLNKLKSSIGAIFGIVSLLSRLKRLVLKFFKHSKIDEMNSQEYDVFEKEEGNHKNSIYS IVSSLAIILGLVGLPYAIIRLFKNIYEKEKQIQQAKIRKKIDSLEFCKADYEFMSRDPGV EMSLKKGDIIAILSKTDTQGNPCEWWQGRKRSGETGWFPSNYCSIISR Protein Names:Recommended name: Peroxisomal membrane protein pex13 Alternative name(s): Peroxin-13 Gene Names:Name:pex13 ORF Names:SPAC3C7.10 Expression Region:1-288 Sequence Info:fµLl length protein