ELISA Recombinant Rat Membrane-associated progesterone receptor component 1(Pgrmc1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P70580 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDEAARKSD Protein Names:Recommended name: Membrane-associated progesterone receptor component 1 Alternative name(s): 25-DX Acidic 25 kDa protein Ventral midline antigen Short name= VEMA Gene Names:Name:Pgrmc1 Synonyms:25dx, Lewi, Pgrmc Expression Region:2-195 Sequence Info:fµLl length protein