ELISA Recombinant Schizosaccharomyces pombe Prohibitin-2(phb2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94550 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNRQRPFQQMNDLMKRGLPKGKYAFTGTGLLLALGLAGFAVQTSLFNVDGGHRAIKYSRI GGIKNLIYPEGTHFLIPWIETAIDYDVRAKPRNISSLTGTKDLQMVNINCRVLSRPDVHA LPKIYRTLGGDYDERVLPSIVNEVLKSVVAQFNASQLITQRERVSRLVRENLMKRAARFN ILLDDVSLTHVQFSPEFTAAVEAKQIAQQDAQRATFYVDRARMEKQGFIVRAQGEGRAAQ LIGEAIKNKPGFIELRKLETAREIANILSKSNNKVmLNASTLLLDDIK Protein Names:Recommended name: Prohibitin-2 Gene Names:Name:phb2 ORF Names:SPCC1322.16 Expression Region:1-288 Sequence Info:fµLl length protein