ELISA Recombinant Rat Lipid phosphate phosphohydrolase 3(Ppap2b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P97544 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTmLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPV DIMDRSNHHNMV Protein Names:Recommended name: Lipid phosphate phosphohydrolase 3 EC= 3.1.3.4 Alternative name(s): Differentially expressed in rat intestine 42 Short name= Dri42 PAP2-beta Phosphatidate phosphohydrolase type 2b Phosphatidic acid phosp Gene Names:Name:Ppap2b Synonyms:Lpp3 Expression Region:1-312 Sequence Info:FµLl length protein