Skip to Content

ELISA Recombinant Sheep Prostaglandin G-H synthase 1(PTGS1)

https://www.anagnostics.com/web/image/product.template/156780/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:P05979 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRP SPSFIHFmLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSN VSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQH FTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQmLNGEVYPP SVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLmLYATIWLREHNRVCDLLKAEHPTWG DEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQL YHWHPLMPDSFRVGPQDYSYEQFLFNTSmLVDYGVEALVDAFSRQPAGRIGGGRNIDHHI LHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFY PGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATL KKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL Protein Names:Recommended name: Prostaglandin G/H synthase 1 EC= 1.14.99.1 Alternative name(s): Cyclooxygenase-1 Short name= COX-1 Prostaglandin H2 synthase 1 Short name= PGH synthase 1 Short name= PGHS-1 Short name= PHS 1 Gene Names:Name:PTGS1 Synonyms:COX1 Expression Region:25-600 Sequence Info:FµLl length protein

1,943.00 € 1943.0 EUR 1,943.00 €

1,943.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.