Skip to Content

ELISA Recombinant Rat Parathyroid hormone 2 receptor(Pth2r)

https://www.anagnostics.com/web/image/product.template/152711/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P70555 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QLDSDGTITIEEQIVLVMKAKMQCELNITAQFQEGEGNCFPEWDGLICWPRGTAGKTSAM PCPSYVYDFNHKGVAFRHCTPNGTWDFIHGSNKTWANYSDCFLQPDINIGKQEFFENLYI LYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFmLRAXSIFVKDRVAQAHLG VEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIF VSFFSDTKYLWGFILIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWIYXXPILAAIG LNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAKSTLVLVLVFGVHYIVFICQPHSFS GLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKTWTRWNLSIDWKKAPPCGGHR YGSVLTTVTHSTSSQSQMGPSTRLVLISSKPAKTACRQIDSHVTLPGYVWSSSEQDCQPQ STPEETKKGHGRQEDDSPVGESSRPVAFTIDTEGCKGESHPI Protein Names:Recommended name: Parathyroid hormone 2 receptor Short name= PTH2 receptor Gene Names:Name:Pth2r Synonyms:Pthr2 Expression Region:25-546 Sequence Info:FµLl length protein

1,886.00 € 1886.0 EUR 1,886.00 €

1,886.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.