ELISA Recombinant Rat Peroxisome biogenesis factor 2(Pex2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P24392 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKLSSWCIPLTSTAGSDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMS EVNAL Protein Names:Recommended name: Peroxisome biogenesis factor 2 Alternative name(s): Peroxin-2 Peroxisomal membrane protein 3 Peroxisome assembly factor 1 Short name= PAF-1 Gene Names:Name:Pex2 Synonyms:Paf1, Pmp35, Pxmp3 Expression Region:1-305 Sequence Info:fµLl length protein