ELISA Recombinant Rat Prenylated Rab acceptor protein 1(Rabac1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O35394 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNV GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPmLLVALAVFFGACYILYLRTLQSKLV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEEL QMEPV Protein Names:Recommended name: Prenylated Rab acceptor protein 1 Alternative name(s): PRA1 family protein 1 Gene Names:Name:Rabac1 Synonyms:Pra1, Praf1 Expression Region:1-185 Sequence Info:FµLl length protein