ELISA Recombinant Saccharomyces pastorianus Protein RER1(RER1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces pastorianus (Lager yeast) (Saccharomyces carlsbergensis) Uniprot NO.:P79003 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDYDSPDPMNGASSNALIAKMNSAKLLYQHYLDKVTPHAKQRWAVLGGLLCLFMVRITMA EGWYVICYGLGLFLLNQFLAFLTPKFDMSLQQDEENNELEAGEKSEEFRPFIRRLPEFKF WYNSIRATVISLVLSLFSIFDIPVFWPILLMYFVLLFFLTMRRQIQHMMKYRYIPLDIGK KKYSHPSN Protein Names:Recommended name: Protein RER1 Alternative name(s): Retention of ER proteins 1 Gene Names:Name:RER1 Expression Region:1-188 Sequence Info:fµLl length protein