ELISA Recombinant Rat E3 ubiquitin-protein ligase RNF152(Rnf152)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:D4A723 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYmLPLPISKERTLLPGDMGCR LLPGSQQKSLTVVTIPAEQQPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF152 EC= 6.3.2.- Alternative name(s): RING finger protein 152 Gene Names:Name:Rnf152 Expression Region:1-203 Sequence Info:FµLl length protein