ELISA Recombinant Xenopus laevis RING finger protein 170(rnf170)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5PPX5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MADNQEERPHFPLDEGSIIEGVSDQVIVVVLLSFVAVGSLIYLLLRNDEQNIHPENQDRV RAVREQLQNEQETPAPPRPQFYSDMTCPVCLQQATFPVETNCGHLFCGSCIIAYWRYGTW LGAINCPICRQTVTLLFPLFGATDQEDAQNILQEATGYNRRFSGQPRSLMDRIMDLPTLL RHAFREMFSVGGLFWMFRIRIVLCLLGALLYLVSPLDIIPEALFGILGFLDDLFVLFLLL IYISIMYREVVTQRLYR Protein Names:Recommended name: RING finger protein 170 Gene Names:Name:rnf170 Expression Region:1-257 Sequence Info:fµLl length protein