ELISA Recombinant Xenopus tropicalis Reactive oxygen species modulator 1(romo1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:A4QNF3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPVAVGPYGQSQPSCFDRVKMGFMMGFAVGMAAGALFGTFSCLRFGMRGRELMGGVGKTM MQSGGTFGTFMAIGMGIRC Protein Names:Recommended name: Reactive oxygen species modµLator 1 Short name= ROS modµLator 1 Alternative name(s): Protein MGR2 homolog Gene Names:Name:romo1 Expression Region:1-79 Sequence Info:fµLl length protein