ELISA Recombinant Rat Sphingosine 1-phosphate receptor 1(S1pr1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P48303 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLI ILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFL REGSMFVALSASVFSLLAIAIERYITmLKMKLHNGSNSSRSFLLISACWVISLILGGLPI MGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRK NISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVL AVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSS HPQKDDGDNPETIMSSGNVNSSS Protein Names:Recommended name: Sphingosine 1-phosphate receptor 1 Short name= S1P receptor 1 Short name= S1P1 Alternative name(s): Endothelial differentiation G-protein coupled receptor 1 Sphingosine 1-phosphate receptor Edg-1 Short name= Gene Names:Name:S1pr1 Synonyms:Edg1 Expression Region:1-383 Sequence Info:FµLl length protein