ELISA Recombinant Rat Sphingosine 1-phosphate receptor 2(S1pr2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P47752 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGGLYSEYLNPEKVQEHYNYTKETLDMQETPSRKVASAFIIILCCAIVVENLLVLIAVAR NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGPVTLSLTPLQWFAREGSAFITLSASV FSLLAIAIERQVAIAKVKLYGSDKSCRmLmLIGASWLISLILGGLPILGWNCLDHLEACS TVLPLYAKHYVLCVVTIFSVILLAIVALYVRIYFVVRSSHADVAGPQTLALLKTVTIVLG VFIICWLPAFSILLLDSTCPVRACPVLYKAHYFFAFATLNSLLNPVIYTWRSRDLRREVL RPLLCWRQGKGATGRRGGNPGHRLLPLRSSSSLERGLHMPTSPTFLEGNTVV Protein Names:Recommended name: Sphingosine 1-phosphate receptor 2 Short name= S1P receptor 2 Short name= S1P2 Alternative name(s): AGR16 Endothelial differentiation G-protein coupled receptor 5 G-protein coupled receptor H218 Sphingos Gene Names:Name:S1pr2 Synonyms:Edg5 Expression Region:1-352 Sequence Info:FµLl length protein