Skip to Content

ELISA Recombinant Sheep Amiloride-sensitive sodium channel subunit beta(SCNN1B)

https://www.anagnostics.com/web/image/product.template/156720/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:O62816 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHLKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFT SLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDALME AVLGRILGPELSQVNATTALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASSSPA PGRPCSARRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMG YPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLIL DMGQEDYVPFLTSTAGARLmLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYS QCTKNGSDVPIQNLYSSYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPDKRKYCNNQE FPDWAHCYSALRISMAQRETCIYACKESCKLLGTSPPLPPCLLPPVSPQDWIFHVLSQER DQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIE FGEIIIDFVWITIIKLVALAKSVRGPPPTVAELVEAHTNFGFQPDSAMPGPDAGAYRREQ NPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI Protein Names:Recommended name: Amiloride-sensitive sodium channel subunit beta Alternative name(s): Beta-NaCH Epithelial Na(+) channel subunit beta Short name= Beta-ENaC Nonvoltage-gated sodium channel 1 subunit beta SCNEB Gene Names:Name:SCNN1B Synonyms:ENAC Expression Region:1-632 Sequence Info:fµLl length protein

2,002.00 € 2002.0 EUR 2,002.00 €

2,002.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.