ELISA Recombinant Rat Syndecan-2(Sdc2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P34900 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ETRAELTSDKDMYLDSSSIEEASGLYPIDDDDYSSASGSGAYEDKGSPDLTTSQLIPRISLTSAAPEVETMTLKTQSITPTQTESPEETDKKEFEISEAEEKQDPAVKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA Protein Names:Recommended name: Syndecan-2 Short name= SYND2 Alternative name(s): Fibroglycan Heparan sµLfate proteoglycan core protein Short name= HSPG CD_antigen= CD362 Gene Names:Name:Sdc2 Synonyms:Hspg1, Synd2 Expression Region:19-201 Sequence Info:fµLl length protein