ELISA Recombinant Rat Syndecan-4(Sdc4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P34901 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGLEQDSDFELSGSGDLDDTEEPRTFPEVISPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRVPSDVGDDDVSNKVSMSSTSQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA Protein Names:Recommended name: Syndecan-4 Short name= SYND4 Alternative name(s): Ryudocan core protein Gene Names:Name:Sdc4 Synonyms:Synd4 Expression Region:24-202 Sequence Info:fµLl length protein