ELISA Recombinant Saccharomyces cerevisiae Translocation protein SEC62(SEC62)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P21825 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAVGPGSNAGASVNGGSATAIATLLRNHKELKQRQGLFQAKQTDFFRYKRFVRALHSEE YANKSARQPEIYPTIPSNKIEDQLKSREIFIQLIKAQMVIPVKKLHSQECKEHGLKPSKD FPHLIVSNKAQLEADEYFVWNYNPRTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYV SLGAFGILAGFFAVAILRLILYVLSLIVYKDVGGFWIFPNLFEDCGVLESFKPLYGFGEK DTYSYKKKLKRMKKKQAKRESNKKKAINEKAEQN Protein Names:Recommended name: Translocation protein SEC62 Alternative name(s): Sec62/63 complex 30 kDa subunit Gene Names:Name:SEC62 Ordered Locus Names:YPL094C ORF Names:LPG14C Expression Region:1-274 Sequence Info:fµLl length protein