ELISA Recombinant Saccharomyces cerevisiae Tricarboxylate transport protein(CTP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P38152 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKT AKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDmLRDSETGELSGTRGVIAGLGAGL LESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSM RQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKT RMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVmLA Protein Names:Recommended name: Tricarboxylate transport protein Alternative name(s): Citrate transport protein Short name= CTP Gene Names:Name:CTP1 Ordered Locus Names:YBR291C ORF Names:YBR2039 Expression Region:1-299 Sequence Info:fµLl length protein