Skip to Content

ELISA Recombinant Rabbit ADP-ATP translocase 1(SLC25A4)

https://www.anagnostics.com/web/image/product.template/151515/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:O46373 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSV QGIIIYRAAYFGVYDTAKGmLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV Protein Names:Recommended name: ADP/ATP translocase 1 Alternative name(s): 30 kDa calsequestrin-binding protein Short name= 30 kDa CSQ-binding protein ADP,ATP carrier protein 1 Adenine nucleotide translocator 1 Short name= ANT 1 Solute Gene Names:Name:SLC25A4 Synonyms:ANT1 Expression Region:2-298 Sequence Info:FµLl length protein

1,648.00 € 1648.0 EUR 1,648.00 €

1,648.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.