ELISA Recombinant Rabbit ADP-ATP translocase 1(SLC25A4)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Oryctolagus cunicµLus (Rabbit)
Uniprot NO.:O46373
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSV QGIIIYRAAYFGVYDTAKGmLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Protein Names:Recommended name: ADP/ATP translocase 1 Alternative name(s): 30 kDa calsequestrin-binding protein Short name= 30 kDa CSQ-binding protein ADP,ATP carrier protein 1 Adenine nucleotide translocator 1 Short name= ANT 1 Solute
Gene Names:Name:SLC25A4 Synonyms:ANT1
Expression Region:2-298
Sequence Info:FµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.