ELISA Recombinant Rat Solute carrier family 25 member 42(Slc25a42)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P0C546 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDNGVQEGSVRLGEDAEAVLAGAVSTKANHRQVLSSLLSGALAGALAKTAVAPLDRTKII FQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGH YYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE EGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIG QSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVG ISFTTFDLMQILLRQLQS Protein Names:Recommended name: Solute carrier family 25 member 42 Gene Names:Name:Slc25a42 Expression Region:1-318 Sequence Info:FµLl length protein