ELISA Recombinant Tachyglossus aculeatus aculeatus ADP-ATP translocase 2(SLC25A5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Tachyglossus acµLeatus acµLeatus (Australian echidna) Uniprot NO.:Q000K2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIMDCVVRI PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKAGDAREFKGLGDCLVKITKSDGIRGLYQGFNVSV QGIIIYRAAYFGIYDTAKGmLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQ SGRKGSDIMYTGTIDCWKKIARDEGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT Protein Names:Recommended name: ADP/ATP translocase 2 Alternative name(s): ADP,ATP carrier protein 2 Adenine nucleotide translocator 2 Short name= ANT 2 Solute carrier family 25 member 5 Gene Names:Name:SLC25A5 Expression Region:2-298 Sequence Info:fµLl length protein