Skip to Content

ELISA Recombinant Rat Very long-chain acyl-CoA synthetase(Slc27a2)

https://www.anagnostics.com/web/image/product.template/153271/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P97524 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRFFLQLANMARQVRSYRQRRPVRTILHVFL EQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWL WLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPELHEAVEEVLPTLKKEGVSVF YVSRTSNTNGVDTVLDKVDGVSADPIPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHH RLWYGTSLALRSGIKAHDVIYTTMPLYHSAALMIGLHGCIVVGATFALRSKFSASQFWDD CRKYNATVIQYIGELLRYLCNTPQKPNDRDHKVKIALGNGLRGDVWREFIKRFGDIHIYE FYASTEGNIGFMNYPRKIGAVGRENYLQKKVVRHELIKYDVEKDEPVRDANGYCIKVPKG EVGLLICKITELTPFFGYAGGKTQTEKKKLRDVFKKGDVYFNSGDLLMIDRENFIYFHDR VGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASIKMKENYEFNGK KLFQHISEYLPSYSRPRFLRIQDTIEITGTFKHRKVTLMEEGFNPSVIKDTLYFMDDTEK TYVPMTEDIYNAIIDKTLKL Protein Names:Recommended name: Very long-chain acyl-CoA synthetase Short name= VLACS Short name= VLCS EC= 6.2.1.- Alternative name(s): Fatty acid transport protein 2 Short name= FATP-2 Fatty-acid-coenzyme A ligase, very long-cha Gene Names:Name:Slc27a2 Synonyms:Acsvl1, Facvl1, Fatp2, Vlacs, Vlcs Expression Region:1-620 Sequence Info:FµLl length protein

1,989.00 € 1989.0 EUR 1,989.00 €

1,989.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.