ELISA Recombinant Rat Zinc transporter 8(Slc30a8)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P0CE46 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEFLERTYLVNDQATKMYAFTSDRERGQKPVNKDQCPGDGPERPEAGAIYHCHNSFKATG NRSSKQVHAKWRLCAASAICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSLFSL WLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDYQIQAGIMITV SGCAVAANIVLTLILHQRHLGHNHKDAQANASVRAAFVHALGDVFQSTSVLISALIIYFK PDYKMADPVCTFISSVLALASTVMILKDFSILLMEGVPKGLSYNSVKELLLTVDGVISVH NLHIWSLTVNQVILSVHVATAASQDSQSVRTGIACALSSSFDLHSLTIQIESAADQDPSC LLCEDPQD Protein Names:Recommended name: Zinc transporter 8 Short name= ZnT-8 Alternative name(s): Solute carrier family 30 member 8 Gene Names:Name:Slc30a8 Synonyms:Znt8 Expression Region:1-368 Sequence Info:FµLl length protein