ELISA Recombinant Rat Heme transporter HRG1(Slc48a1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:B0BNL4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPTRLQLGVRAAYSGFSSLAGFSIFFVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYM QDYWRTWLRGLRGFFFVGALFSAVSFSAFCTFLTLAITQHQSFKDPNSYYLSCVWSFISF KWAFLLSLYAHRYRADFADISILSDF Protein Names:Recommended name: Heme transporter HRG1 Alternative name(s): Heme-responsive gene 1 protein homolog Short name= HRG-1 Solute carrier family 48 member 1 Gene Names:Name:Slc48a1 Synonyms:Hrg1 Expression Region:1-146 Sequence Info:FµLl length protein