ELISA Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1(Srd5a1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P24008 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVPLMELDELCLLDmLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQE LPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLA FLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGE TGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWY HEKFEDYPKSRKILIPFVL Protein Names:Recommended name: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5 Alternative name(s): SR type 1 Steroid 5-alpha-reductase 1 Short name= S5AR 1 Gene Names:Name:Srd5a1 Expression Region:1-259 Sequence Info:FµLl length protein