ELISA Recombinant Rat Type 2 lactosamine alpha-2,3-sialyltransferase(St3gal6)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P61943
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSGLSKLQSCDLVGQFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN
Protein Names:Recommended name: Type 2 lactosamine alpha-2,3-sialyltransferase EC= 2.4.99.- Alternative name(s): CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI ST3Gal VI Short name= ST3GalVI Sialyltransferase 10
Gene Names:Name:St3gal6 Synonyms:Siat10
Expression Region:1-331
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.