Skip to Content

ELISA Recombinant Rat Steryl-sulfatase(Sts)

https://www.anagnostics.com/web/image/product.template/153004/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P15589 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ARPGPGPNFLLIMADDLGIGDLGCYGNRTLRTPHIDRLALEGVKLTQHLAAAPLCTPSRA AFLTGRYPVRSGMASHGRLGVFLFSASSGGLPPNEVTFAKLLKGQGYTTGLVGKWHLGLS CQAASDFCHHPGRHGFDRFLGTPTTNLRDCKPGGGTVFGSAQQVFVVLPMNILGAVLLAM ALARWAGLARPPGWVFGVTVAAMAAVGGAYVAFLYHFRPANCFLMADFTITQQPTDYKGL TQRLASEAGDFLRRNRDTPFLLFLSFMHVHTAHFANPEFAGQSLHGAYGDAVEEMDWAVG QVLATLDKLGLANNTLVYLTSDHGAHVEELGPNGERHGGSNGIYRGGKANTWEGGIRVPG LVRWPGVIVPGQEVEEPTSNMDVFPTVARLAGAELPTDRVIDGRDLMPLLLGHVQHSEHE FLFHYCNAYLSAVAWRPHNSSSVWKAFYFTPNFDPPGSNGCFSTHVCMCHGHHVTHHDPP LLFDIARDPRERHPLTPETEPRHGEILRNMDAAARAHVATLEEAPNQLSMSNVAWKPWLQ LCLPSKPHPLACRCAGDG Protein Names:Recommended name: Steryl-sµLfatase EC= 3.1.6.2 Alternative name(s): ArylsµLfatase C Short name= ASC Steroid sµLfatase Steryl-sµLfate sµLfohydrolase Gene Names:Name:Sts Expression Region:20-577 Sequence Info:FµLl length protein

1,924.00 € 1924.0 EUR 1,924.00 €

1,924.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.