ELISA Recombinant Rat Succinate receptor 1(Sucnr1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6IYF9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQNLSCENWLALENILKKYYLSAFYGIEFIVGmLGNFTVVFGYLFCMKNWNSSNVYLFN LSISDLAFLCTLPmLIRSYATGNWTYGDVLCISNRYVLHANLYTSILFLTFISIDRYLLM KFPFREHILQKKEFAILISLAVWVLVTLEVLPmLTFITSTPIEKGDSCVDYASSGNPKYS LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKKRSQQQATVLSLNKPLRLVVLAVVIFSVL FTPYHIMRNVRIASRLDSWPQGCSQKAIKCLYILTRPLAFLNSAVNPIFYFLVGDHFRDM LFSKLRQYFKSLTSFRL Protein Names:Recommended name: Succinate receptor 1 Alternative name(s): G-protein coupled receptor 91 Gene Names:Name:Sucnr1 Synonyms:Gpr91 Expression Region:1-317 Sequence Info:fµLl length protein