ELISA Recombinant Takifugu rubripes Surfeit locus protein 1(surf1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Takifµgu rubripes (Japanese pufferfish) (Fµgu rubripes) Uniprot NO.:O57593 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SFLKWFLLLIPATTFGLGTWQVKRRQWKMELIDGLTKLTTAEPIPLPIDPAELSSLEYRR VKMRGKYDHSKELYILPRSPVDPEKEAREAGRLSSSGETGANVITPFHVTDLGITILVNR GYVPKKKIRPETRMKGQVEGEMEVVGVVRLTETRKPFVPNNDVERNHWHYRDLEAMCQVT GAEPIFVDADFSSTVPGGPIGGQTRVTLRNEHMQYIVTWYGLCAATSYMWFAKFIKKIKV Protein Names:Recommended name: Surfeit locus protein 1 Gene Names:Name:surf1 Synonyms:surf-1 Expression Region:1-240 Sequence Info:fµLl length protein