ELISA Recombinant Rat Synaptogyrin-2(Syngr2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O54980 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESGAYGAANAGGSFDLRRYVSQPQVVTRLVSMVLALIVFSCIFGEGYINLHSSDQLHCV FNRNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKPDDVLVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQN YVDPTPDPTTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY Protein Names:Recommended name: Synaptogyrin-2 Alternative name(s): Cellµgyrin Gene Names:Name:Syngr2 Expression Region:1-224 Sequence Info:FµLl length protein