Skip to Content

ELISA Recombinant Rabbit Neuromedin-K receptor(TACR3)

https://www.anagnostics.com/web/image/product.template/151595/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:O97512 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDSFAAAETWTDAAGGAGADGRNLSAALAAGAAAEALGTEWLQLLVQAGNLSSSLPSSVP GLPTTSPAPSQPRANLTNQFVQPSWRIALWSLAYGVVVAVAVFGNLIVIWIILAHKRMRT VTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTA IAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLALPQCLYSKTKVMPGRTLCYVQWP EGPKQHFIYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVV KMMIIVVVTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCC LNKRFRAGFKRAFRWCPFIQVSSYDELELKTTRFHPTRQSSLYTVTRMESMTVVFDPSDA DNTRSSRKKRATPGDPNFNGCSRRNSKSASTTSSFISSPYTSMEEYS Protein Names:Recommended name: Neuromedin-K receptor Short name= NKR Alternative name(s): NK-3 receptor Short name= NK-3R Neurokinin B receptor Tachykinin receptor 3 Gene Names:Name:TACR3 Expression Region:1-467 Sequence Info:FµLl length protein

1,828.00 € 1828.0 EUR 1,828.00 €

1,828.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.