ELISA Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim17-A(Timm17a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:O35092 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAP QLGGSFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGG ILLALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSPFGDYRQYQ Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit Tim17-A Alternative name(s): Inner membrane preprotein translocase Tim17a Gene Names:Name:Timm17a Synonyms:Mimt17, Tim17, Tim17a, Timm17 Expression Region:1-171 Sequence Info:FµLl length protein