ELISA Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23(TIM23)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P32897 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM23 Alternative name(s): Membrane import machinery protein MIM23 Mitochondrial protein import protein 3 Mitochondrial protein import protein MAS6 Gene Names:Name:TIM23 Synonyms:MAS6, MIM23, MPI3 Ordered Locus Names:YNR017W ORF Names:N3180 Expression Region:1-222 Sequence Info:fµLl length protein