ELISA Recombinant Rat Bax inhibitor 1(Tmbim6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P55062 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLS ALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMG TAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSLGNLFFGSIWLFQANLYMGLLV MCGFVLFDTQLIIEKAEHGDKDYIWHCIDLFLDFVTLFRKLmLILAFNEKDKKKEKK Protein Names:Recommended name: Bax inhibitor 1 Short name= BI-1 Alternative name(s): Testis-enhanced gene transcript protein Transmembrane BAX inhibitor motif-containing protein 6 Gene Names:Name:Tmbim6 Synonyms:Bi1, Tegt Expression Region:1-237 Sequence Info:FµLl length protein