ELISA Recombinant Saccharomyces cerevisiae Bax inhibitor 1(BXI1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P48558 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSC QLLASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPL LTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLIT TIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFGWNTHSSKFNLLY GWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMmLYLDIVNLFLSILRILANSNDDN Protein Names:Recommended name: Bax inhibitor 1 Alternative name(s): BH3 domain-containg protein BXI1 Gene Names:Name:BXI1 Synonyms:YBH3 Ordered Locus Names:YNL305C ORF Names:N0405 Expression Region:1-297 Sequence Info:fµLl length protein