ELISA Recombinant Rat Transmembrane protein 176B(Tmem176b)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q925D4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQATVTVDGVKVTSTRPQSAQISIHIHHKSALEQLLGAMGSLKKFLSYPQARIHYGQLS LGVTQILLGLVSCVLGVCLYFGPWTELCASGCAFWSGSVAILAGVGIVIHEMGQGKLSGH ISRLLLLACSATAAAATVMGVKSLIWQTSASYYFEISSTCDSLQPSIVDRFRSVRFTDDS DWRTERCREYLRMMMNLFLAFCILFTVICILKIVVSVASLGLSLRSMCGRNSQVLNDEET EKKLLGGDSAPASPTKEKIPVTP
Protein Names:Recommended name: Transmembrane protein 176B Alternative name(s): Protein LR8 Tolerance-related and induced transcript protein
Gene Names:Name:Tmem176b Synonyms:Lr8, Torid
Expression Region:1-263
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.