ELISA Recombinant Rat Transmembrane protein 196(Tmem196)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5EB63 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHTPQLGDSSPFLLCGICGILC AKKKSGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIGIGGCTV SSWLTCRLASYEQRRMFSEREHSLHHSHEMAEKEVTDNMSNGAPQLIFNGRVQSMF Protein Names:Recommended name: Transmembrane protein 196 Gene Names:Name:Tmem196 Expression Region:1-176 Sequence Info:fµLl length protein