ELISA Recombinant Rat Transmembrane protein 35(Tmem35)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6JAM9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS Protein Names:Recommended name: Transmembrane protein 35 Alternative name(s): Spinal cord expression protein 4 TMEM35 gene-derived unknown factor 1 Gene Names:Name:Tmem35 Synonyms:Tuf1 Expression Region:1-167 Sequence Info:fµLl length protein