ELISA Recombinant Rat Trimeric intracellular cation channel type A(Tmem38a)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:A6ZIQ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLISSLSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGSVELSRRHPVASWLCAmL HCFGSYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVA MKEVVRVRKIAVGIHHAHHYHHGWFIMIATGWVKGSGVALLSNLEQLLRGVWKPETNEIL HMSFPTKASLYGAILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDVLE GYICPVLFGATWGGDHHHDNHGAPHGMGLGTQHSGLPAKAKEELSEGFRKKKTKKAD Protein Names:Recommended name: Trimeric intracellµLar cation channel type A Short name= TRIC-A Short name= TRICA Alternative name(s): 27 kDa sarcoplasmic reticµLum protein SPR-27 Transmembrane protein 38A Gene Names:Name:Tmem38a Expression Region:1-297 Sequence Info:fµLl length protein