ELISA Recombinant Xenopus tropicalis Transmembrane protein 45B(tmem45b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5XGD7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANFKGHALPGSFFLVFGLWWSVKYPLKYLNSKVKGNCRSNKCYERLELIEGILKAAFAL IGILAEQFVPDGPHMHLVNGEDHSWVKLMNWQHTTMYLFYGISGVVDILTFLPLNLPRGL DRLSLGIAVIIEGLLFYYHVHNRPALDQHIHSLLLIAVFGGAISIMIEVFMRNDIVLELF RSSLTILQGTWFWQIGFVLYPLGGAPEWDQTDHGNVMFITMCFCWHYAVALLIMAINYSL VYCCVKRHKKLSSVVDNSLKKINSNKTEVEASLLAGSDEE Protein Names:Recommended name: Transmembrane protein 45B Gene Names:Name:tmem45b ORF Names:TNeu104l01.1 Expression Region:1-280 Sequence Info:fµLl length protein