ELISA Recombinant Xenopus laevis Transmembrane protein 47(tmem47)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6IP19 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASSASGMEEVRSSVLTPLKLVGLVCIFLALCLDIGAVLSPAWVTADNQYYLSLWESCKK SENRWICDSTLQSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVmLFAA VVLQVCGLVLYPIKFIETVTLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY Protein Names:Recommended name: Transmembrane protein 47 Alternative name(s): Transmembrane 4 superfamily member 10 Gene Names:Name:tmem47 Synonyms:tm4sf10 Expression Region:1-179 Sequence Info:fµLl length protein