ELISA Recombinant Rat Transmembrane protein 55A(Tmem55a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q4V888 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPGTSGIPVINCRV CQSLINLDGKLHQHVVKCTVCNEATPIKTPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPImLISEEQPAQPALPVQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYVTIGMICIFIGVGLTVGTQDFSRRFHATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHGFA Protein Names:Recommended name: Transmembrane protein 55A EC= 3.1.3.78 Alternative name(s): PtdIns-4,5-P2 4-Ptase II Type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase Gene Names:Name:Tmem55a Expression Region:1-257 Sequence Info:fµLl length protein