ELISA Recombinant Xenopus tropicalis Transmembrane protein 85(tmem85)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6PBF7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATPSNLVANRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHI LVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLL ESSGQRFLQGLVYLIGNLLGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGLLL Protein Names:Recommended name: Transmembrane protein 85 Gene Names:Name:tmem85 Expression Region:1-180 Sequence Info:fµLl length protein