ELISA Recombinant Rabbit Tumor necrosis factor(TNF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:P04924 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTESMIRDVELAEGPLPKKAGGPQGSKRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQEEEQSPNNLHLVNPVAQMVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL Protein Names:Recommended name: Tumor necrosis factor Alternative name(s): Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name= TNF-a Cleaved into the following 6 chains: 1. Tumor necrosis factor, membrane form Alternative name(s): N-terminal fragment Short name= NTF IntracellµLar domain 1 Short name= ICD1 IntracellµLar domain 2 Short name= ICD2 C-domain 1 C-domain 2 Tumor necrosis factor, soluble form Gene Names:Name:TNF Synonyms:TNFA, TNFSF2 Expression Region:1-235 Sequence Info:fµLl length protein